Structure of PDB 4v4i Chain h

Receptor sequence
>4v4ih (length=155) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQ
EKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLAL
RWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAY
AHYRW
3D structure
PDB4v4i Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements
Chainh
Resolution3.71 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h R3 R4 R5 R6 A7 E8 R10 K29 M31 R32 D33 K35 K36 R78 R79 R95 S98 R102 W156 R2 R3 R4 R5 A6 E7 R9 K28 M30 R31 D32 K34 K35 R77 R78 R94 S97 R101 W155
BS02 rna h R79 Q86 D140 R143 M144 R78 Q85 D139 R142 M143
BS03 rna h G82 N84 G81 N83
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4i, PDBe:4v4i, PDBj:4v4i
PDBsum4v4i
PubMed16962654
UniProtP17291|RS7_THET8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]