Structure of PDB 3jd5 Chain h

Receptor sequence

>3jd5h (length=103) Species: 9913 (Bos taurus)

PFQNGFEEMIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLDKYLEGFP
KQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKQDILKESGI
NFS

3D structure

• PDB: 3jd5 Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
• Chain: h
• Resolution: 7.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	h	F324 R339	F41 R56

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jd5, PDBe:3jd5, PDBj:3jd5
• PDBsum: 3jd5
• PubMed: 24799711
• UniProt: P82925|RT31_BOVIN Small ribosomal subunit protein mS31 (Gene Name=MRPS31)