Structure of PDB 8ip9 Chain gb

Receptor sequence

>8ip9gb (length=151) Species: 4565 (Triticum aestivum) [Search protein sequence]

MKLNIANPTTGCQKKVEIDDDMKLRNLYDKRISQEVVGDLLGEEFEGYIF
KIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTSCFRGHGRRVGERRRKSVR
GCIVSQDLSVINLVIVKKGTPLTLQRKRARIADKKKRIAKKKSEAAEYQK
L

3D structure

PDB

8ip9 Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	gb	K2 N4 P8 Q13 K15 M53 G54 C56 D57 Q59 G60 P62 G66 V67 R72 L76 C83 R85 G86 H87 R90 V91 G92 E93 R94 R95 R96 K97 S98 N112 P186 Q190 R191 R193 R195 K199 R202	K2 N4 P8 Q13 K15 M53 G54 C56 D57 Q59 G60 P62 G66 V67 R72 L76 C83 R85 G86 H87 R90 V91 G92 E93 R94 R95 R96 K97 S98 N112 P121 Q125 R126 R128 R130 K134 R137

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ip9, PDBe:8ip9, PDBj:8ip9
PDBsum	8ip9
PubMed	38267667
UniProt	A0A2X0SLI3

[Back to BioLiP]