Structure of PDB 8bpo Chain g2

Receptor sequence

>8bpog2 (length=122) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA

3D structure

PDB

8bpo Mechanism of ribosome-associated mRNA degradation during tubulin autoregulation.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g2	R70 K74 K76 Y78 K79 R84 R89 R93 R94 L95 N96 K97 H98 E100 K106 R109 R112	R69 K73 K75 Y77 K78 R83 R88 R92 R93 L94 N95 K96 H97 E99 K105 R108 R111
BS02	rna	g2	A6 R10 K35 S45 R48 K52 A55 R56 L58 T59 N62 K66 R70 L81 R84 P85 K86 T88 R89 R92	A5 R9 K34 S44 R47 K51 A54 R55 L57 T58 N61 K65 R69 L80 R83 P84 K85 T87 R88 R91

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8bpo, PDBe:8bpo, PDBj:8bpo
PDBsum	8bpo
PubMed	37295431
UniProt	G1SIT5\|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)