Structure of PDB 7r81 Chain g1

Receptor sequence

>7r81g1 (length=121) Species: 5141 (Neurospora crassa) [Search protein sequence]

AAKKHVPIVKKRSKGFMRHQSDRFMRVDSAWRKPKGIDNRVRRRFRGTLA
MPSIGYGSNKKTRHMMPSGHKAFLVSNVKDVELLLMHNKTYAAEIAHNVS
SRKRIEIIARAKQLSVKVTNA

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g1	V8 K12 K13 K16 F18 M19 R20 Q22 D24 R25 M27 R28 V29 W33 R34 K35 K37 G38 I39 D40 N41 R42 R44 R45 R46 R48 P54 S55 I56 G57 Y58 G59 S60 N61 K62 K63 R65 H66 P69 S70 L76 N79 E96 A98 H99 N100 S102 S103 R104 K105 R106 K119 N122	V6 K10 K11 K14 F16 M17 R18 Q20 D22 R23 M25 R26 V27 W31 R32 K33 K35 G36 I37 D38 N39 R40 R42 R43 R44 R46 P52 S53 I54 G55 Y56 G57 S58 N59 K60 K61 R63 H64 P67 S68 L74 N77 E94 A96 H97 N98 S100 S101 R102 K103 R104 K117 N120

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum	7r81
PubMed	34815343
UniProt	Q7RXY1\|RL32_NEUCR Large ribosomal subunit protein eL32 (Gene Name=crp-63)