Structure of PDB 7oyb Chain g1

Receptor sequence

>7oybg1 (length=104) Species: 7955 (Danio rerio) [Search protein sequence]

VQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKTGKSPKSACGICPG
RLRGIRAVRPQVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQK
IVVK

3D structure

PDB

7oyb A molecular network of conserved factors keeps ribosomes dormant in the egg.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g1	V2 R4 L5 T6 Y7 R8 R9 R10 L11 S12 Y13 N14 T15 S17 R21 L22 R24 T25 P26 G27 N28 R29 Y32 L33 Y34 K36 K37 K40 P42 K43 A45 I48 R54 G55 I56 R57 R60 P61 Q62 L64 M65 R66 S68 K69 T70 K72 H73 S75 R76 A77 Y78 G79 G80 S81 A84 R90 R93 A94 L96 I97 E98 Q100 K101	V1 R3 L4 T5 Y6 R7 R8 R9 L10 S11 Y12 N13 T14 S16 R20 L21 R23 T24 P25 G26 N27 R28 Y31 L32 Y33 K35 K36 K39 P41 K42 A44 I47 R53 G54 I55 R56 R59 P60 Q61 L63 M64 R65 S67 K68 T69 K71 H72 S74 R75 A76 Y77 G78 G79 S80 A83 R89 R92 A93 L95 I96 E97 Q99 K100
BS02	ZN	g1	C49 C86	C48 C85

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7oyb, PDBe:7oyb, PDBj:7oyb
PDBsum	7oyb
PubMed	36653451
UniProt	Q7ZWJ7\|RL34_DANRE Large ribosomal subunit protein eL34 (Gene Name=rpl34)