Structure of PDB 8v9l Chain g

Receptor sequence
>8v9lg (length=155) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
PRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLEGKKSLAERIVYGALEQAR
EKTGTDPVVTLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLAL
RWLVNFSRQRREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRAF
AHYRW
3D structure
PDB8v9l A new family of bacterial ribosome hibernation factors
Chaing
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g R3 K4 P6 A7 K9 R10 N28 K29 G34 K36 L38 R41 R76 R79 R95 R102 R109 K114 M116 W156 R2 K3 P5 A6 K8 R9 N27 K28 G33 K35 L37 R40 R75 R78 R94 R101 R108 K113 M115 W155
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v9l, PDBe:8v9l, PDBj:8v9l
PDBsum8v9l
PubMed38355796
UniProtA0QS97|RS7_MYCS2 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]