Structure of PDB 8uri Chain g |
>8urig (length=66) Species: 562 (Escherichia coli) [Search protein sequence] |
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRD VATGGRVDRFNKRFNI |
|
PDB | 8uri Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome |
Chain | g |
Resolution | 5.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
g |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|