Structure of PDB 8p2f Chain g

Receptor sequence
>8p2fg (length=93) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
RTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYE
INDFKDGFYNIVRVKSDNNKATDEFQRLAKISDDIIRYMVIRE
3D structure
PDB8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Chaing
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g R2 Y4 Y50 K81 R88 V91 I92 R93 R1 Y3 Y49 K80 R87 V90 I91 R92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum8p2f
PubMed38902339
UniProtQ2G113|RS6_STAA8 Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]