Structure of PDB 8ow0 Chain g

Receptor sequence

>8ow0g (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNI

3D structure

PDB

8ow0 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	g	R37 R44 I45 G46 S47	R21 R28 I29 G30 S31
BS02	dna	g	Q17 S18 R19 S20 K22 R34	Q1 S2 R3 S4 K6 R18

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006281	DNA repair
GO:0006325	chromatin organization
GO:0031507	heterochromatin formation

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex

External links

PDB	RCSB:8ow0, PDBe:8ow0, PDBj:8ow0
PDBsum	8ow0
PubMed	37506202
UniProt	P04911\|H2A1_YEAST Histone H2A.1 (Gene Name=HTA1)