Structure of PDB 8jdj Chain g

Receptor sequence

>8jdjg (length=104) Species: 9606 (Homo sapiens) [Search protein sequence]

AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK
KGLKKMQANNAKAMSARAEAIKALVVSRKLDRLAYIAHPKLGKRARARIA
KGLR

3D structure

PDB

8jdj Glycosylated queuosines in tRNAs optimize translational rate and post-embryonic growth.

Chain

Resolution

2.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	K3 K5 N6 H7 T8 T9 H10 N11 Q12 S13 R14 K15 H17 R18 N19 S26 Q27 R28 Y29 L32 K33 D36 F39 R41 N42 R44 F45 A46 K47 K48 H49 N50 K51 K52 K55 K56 M57 N61 S90 R91 R95 Y98 H101 P102 A108 R111 R117	K2 K4 N5 H6 T7 T8 H9 N10 Q11 S12 R13 K14 H16 R17 N18 S25 Q26 R27 Y28 L31 K32 D35 F38 R40 N41 R43 F44 A45 K46 K47 H48 N49 K50 K51 K54 K55 M56 N60 S77 R78 R82 Y85 H88 P89 A95 R98 R104
BS02	MG	g	S4 K5	S3 K4

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008201	heparin binding
GO:0045296	cadherin binding

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8jdj, PDBe:8jdj, PDBj:8jdj
PDBsum	8jdj
PubMed	37992713
UniProt	P47914\|RL29_HUMAN Large ribosomal subunit protein eL29 (Gene Name=RPL29)