Structure of PDB 8fru Chain g

Receptor sequence

>8frug (length=97) Species: 941442 (Giardia intestinalis assemblage A) [Search protein sequence]

MADCRVTCRFHSTYRTRSKIVRYKRTPGNRLTSLRVKKLPNAPHCAETGK
QIHGIPRVIPQHLTRQQRKVSRPYGGKLCGSALRAHILESFLNEENQ

3D structure

PDB

8fru The Giardia lamblia ribosome structure reveals divergence in several biological pathways and the mode of emetine function.

Chain

Resolution

2.49 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	A2 D3 R5 V6 T7 R9 H11 S12 T13 Y14 R15 R17 S18 Y23 K24 R25 T26 P27 G28 N29 R30 T32 K37 K38 L39 N41 P43 K50 H53 G54 P60 Q61 H62 R65 Q66 R68 S71 R72 P73 G75	A2 D3 R5 V6 T7 R9 H11 S12 T13 Y14 R15 R17 S18 Y23 K24 R25 T26 P27 G28 N29 R30 T32 K37 K38 L39 N41 P43 K50 H53 G54 P60 Q61 H62 R65 Q66 R68 S71 R72 P73 G75

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links