Structure of PDB 8eug Chain g

Receptor sequence

>8eugg (length=106) Species: 4896 (Schizosaccharomyces pombe)

QRVTYRRRLAYNTRSNRTRIIKTPGNNIRYLHIKKLGTIPRCGDTGVPLQ
GIPALRPREFARLSHNKKTVQRAYGGCLSANAVKDRIVRAFLIEEQKIVK
QKLKQL

3D structure

• PDB: 8eug Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: g
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	R4 V5 T6 Y7 R8 R9 R10 L11 Y13 N14 T15 R16 S17 R19 R21 I22 K24 T25 P26 G27 N28 R31 Y32 L33 K37 T40 P42 R43 Q52 G53 P55 R58 P59 R60 A63 R64 S66 H67 N68 K70 T71 V72 Q73 R74 Y76 G77 G78 A82 N83 R88 R91 A92 I95 E96 Q98 K102	R2 V3 T4 Y5 R6 R7 R8 L9 Y11 N12 T13 R14 S15 R17 R19 I20 K22 T23 P24 G25 N26 R29 Y30 L31 K35 T38 P40 R41 Q50 G51 P53 R56 P57 R58 A61 R62 S64 H65 N66 K68 T69 V70 Q71 R72 Y74 G75 G76 A80 N81 R86 R89 A90 I93 E94 Q96 K100

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8eug, PDBe:8eug, PDBj:8eug
• PDBsum: 8eug
• PubMed: 36423630
• UniProt: O42846|RL34A_SCHPO Large ribosomal subunit protein eL34A (Gene Name=rpl3401)