Structure of PDB 8bh7 Chain g

Receptor sequence

>8bh7g (length=147) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

VPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVEQRSGR
DALEVFEEAINNIMPVLEVKARRSNYQVPVEVRPERRTTLGLRWLVNYAR
LRGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW

3D structure

PDB

8bh7 Ribosome maturation factor P (RimP) from Staphylococcus aureus

Chain

Resolution

4.23 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	V7 K9 D11 N28 K29 M31 D33 G34 K35 R36 G37 T38 R41 I42 K76 A77 R78 R79 R92 E94 R95 T98 L99 R102 R109 G112 K114 T115 M116 R119 W156	V1 K3 D5 N22 K23 M25 D27 G28 K29 R30 G31 T32 R35 I36 K70 A71 R72 R73 R83 E85 R86 T89 L90 R93 R100 G103 K105 T106 M107 R110 W147

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8bh7, PDBe:8bh7, PDBj:8bh7
PDBsum	8bh7
PubMed
UniProt	P48940\|RS7_STAA8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)