Structure of PDB 8azw Chain g

Receptor sequence

>8azwg (length=209) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

GRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVH
LVSWEKENVSSEALEAARIACNKYMTKSAGKDAFHLRVRVHPFHVLRINK
MQTGMRGAFGKPQGVCARVAIGQVLLSVRCKDGNANHAQEALRRAKFKFP
GRQKIIVSRKWGFTKFSRTDYLKYKSENRIIPDGVNAKLLGCHGRLAARQ
PGRAFLEAV

3D structure

PDB

8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.14 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	E56 I131 C202 H203 G204 L206 R209	E55 I121 C192 H193 G194 L196 R199
BS02	rna	g	R3 R4 A6 R7 K13 N14 K15 P16 F22 R24 K30 D35 K39 K40 E63 A64 A67 K74 R90 H92 F94 R98 I99 N100 M102 G114 M115 R116 A118 F119 G120 Q133 R154 F157 K158 P160 K175 D193 G194 N196 K198	R2 R3 A5 R6 K12 N13 K14 P15 F21 R23 K29 D34 K38 K39 E62 A63 A66 K73 R89 H91 F93 R97 I98 N99 M101 G104 M105 R106 A108 F109 G110 Q123 R144 F147 K148 P150 K165 D183 G184 N186 K188

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8azw, PDBe:8azw, PDBj:8azw
PDBsum	8azw
PubMed	37156858
UniProt	A0A1S3Z2D7

[Back to BioLiP]