Structure of PDB 7z34 Chain g

Receptor sequence

>7z34g (length=112) Species: 559292 (Saccharomyces cerevisiae S288C)

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK

3D structure

• PDB: 7z34 Visualizing maturation factor extraction from the nascent ribosome by the AAA-ATPase Drg1.
• Chain: g
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	R4 V5 T6 F7 R8 R9 R10 P12 Y13 N14 T15 S17 K24 T25 P26 G27 Q33 L38 R41 P42 K43 G45 Q52 I54 T56 R60 T64 S66 K67 T68 H69 K70 S73 A75 Y76 R91 A92 L94 I95	R3 V4 T5 F6 R7 R8 R9 P11 Y12 N13 T14 S16 K23 T24 P25 G26 Q32 L37 R40 P41 K42 G44 Q51 I53 T55 R59 T63 S65 K66 T67 H68 K69 S72 A74 Y75 R90 A91 L93 I94

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7z34, PDBe:7z34, PDBj:7z34
• PDBsum: 7z34
• PubMed: 36097293
• UniProt: P87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)