Structure of PDB 7y41 Chain g

Receptor sequence
>7y41g (length=48) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
MKTGIHPEYVDTTVQCGCGHSFTTRSTKQSGTIVVEVCSQCHPFYTGK
3D structure
PDB7y41 Cryo-EM structures reveal a unique conformational dynamics of the Mycobacterium 23S rRNA helices
Chaing
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g M1 K2 I5 H6 M1 K2 I5 H6
BS02 ZN g C16 C18 C38 C41 C16 C18 C38 C41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y41, PDBe:7y41, PDBj:7y41
PDBsum7y41
PubMed37709237
UniProtA0R215|RL31_MYCS2 Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]