Structure of PDB 7uvy Chain g

Receptor sequence
>7uvyg (length=136) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
PRRRVVAAREILPDPKFSSQTIAKFMNHVMQDGKKSIAESIVYGALERVQ
EKNKVDPVEFFETTLEKVRPMVEVVPMEVRPSRRTALAMRWLVDAAAKRS
EKTMALRLAGELLDAAEGKGAAIKKREDVHRMAEAN
3D structure
PDB7uvy Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
Chaing
Resolution2.39 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g P2 R3 R4 V7 R10 K25 N28 M31 D33 G34 K35 K36 S37 I38 I42 R92 R95 R102 K114 M116 P1 R2 R3 V6 R9 K24 N27 M30 D32 G33 K34 K35 S36 I37 I41 R80 R83 R90 K102 M104
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvy, PDBe:7uvy, PDBj:7uvy
PDBsum7uvy
PubMed37192172
UniProtB7I7S0|RS7_ACIB5 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]