Structure of PDB 7qi5 Chain g

Receptor sequence
>7qi5g (length=134) Species: 9606 (Homo sapiens) [Search protein sequence]
PDYPRFVESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNL
PYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLL
GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
3D structure
PDB7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
Chaing
Resolution2.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g S89 R90 M91 N93 Y97 K98 T101 H102 N104 R105 R111 K112 N141 K150 S57 R58 M59 N61 Y65 K66 T69 H70 N72 R73 R79 K80 N109 K118
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
PDBsum7qi5
PubMed38769321
UniProtQ13405|RM49_HUMAN Large ribosomal subunit protein mL49 (Gene Name=MRPL49)

[Back to BioLiP]