Structure of PDB 7pwg Chain g

Receptor sequence

>7pwgg (length=99) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

ADCRVTCRFHSTYRTRSKIVRYKRTPGNRLTSLRVKKLPNAPHCAETGKQ
IHGIPRVIPQHLTRQQRKVSRPYGGKLCGSALRAHILESFLNEENQALR

3D structure

PDB

7pwg Cryo-EM structure of the ancient eukaryotic ribosome from the human parasite Giardia lamblia.

Chain

Resolution

2.75 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	D3 R5 V6 T7 R9 H11 S12 T13 Y14 R15 T16 R17 K19 K24 R25 T26 P27 G28 T32 K37 K38 L39 N41 P43 H44 K50 H53 G54 R57 Q61 H62 R65 Q66 R68 S71 R72 Y74 K77	D2 R4 V5 T6 R8 H10 S11 T12 Y13 R14 T15 R16 K18 K23 R24 T25 P26 G27 T31 K36 K37 L38 N40 P42 H43 K49 H52 G53 R56 Q60 H61 R64 Q65 R67 S70 R71 Y73 K76

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links