Structure of PDB 7pai Chain g

Receptor sequence
>7paig (length=126) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
AKKDKAQQVADVSHLLSTSAGFVIFDYTSMSAIEATSIRKKLFKNGSKIK
VIKNNILRRALKAGKFEGIDETAIKGKLAVAVGVNEIVETLKAVDGVVKA
KEAMNFVCGYFDNRAFNSADLEKIAK
3D structure
PDB7pai Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chaing
Resolution6.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g K7 T30 S31 M32 A34 T38 R41 I51 K52 V53 K55 N56 N57 R61 A75 G78 K79 L80 K5 T28 S29 M30 A32 T36 R39 I49 K50 V51 K53 N54 N55 R59 A73 G76 K77 L78
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pai, PDBe:7pai, PDBj:7pai
PDBsum7pai
PubMed36171285
UniProtP75240|RL10_MYCPN Large ribosomal subunit protein uL10 (Gene Name=rplJ)

[Back to BioLiP]