Structure of PDB 7on1 Chain g

Receptor sequence
>7on1g (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNI
3D structure
PDB7on1 Cenp-A nucleosome in complex with Cenp-C
Chaing
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide g Y59 E63 D92 D93 E94 Y43 E47 D76 D77 E78
BS02 dna g I45 G46 S47 I29 G30 S31
BS03 dna g S18 R34 R79 S2 R18 R63
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7on1, PDBe:7on1, PDBj:7on1
PDBsum7on1
PubMed
UniProtP04911|H2A1_YEAST Histone H2A.1 (Gene Name=HTA1)

[Back to BioLiP]