Structure of PDB 7oid Chain g

Receptor sequence
>7oidg (length=129) Species: 9606 (Homo sapiens) [Search protein sequence]
FVESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVR
RSRMHNIPVYKDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPV
TQVNEVTGTLRIKGYFDQELKAWLLEKGF
3D structure
PDB7oid A distinct assembly pathway of the human 39S late pre-mitoribosome.
Chaing
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g S89 R90 M91 N93 Y97 K98 H102 G103 N104 R105 R111 K112 N141 T144 K150 S52 R53 M54 N56 Y60 K61 H65 G66 N67 R68 R74 K75 N104 T107 K113
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oid, PDBe:7oid, PDBj:7oid
PDBsum7oid
PubMed34315873
UniProtQ13405|RM49_HUMAN Large ribosomal subunit protein mL49 (Gene Name=MRPL49)

[Back to BioLiP]