Structure of PDB 7nww Chain g

Receptor sequence
>7nwwg (length=208) Species: 562 (Escherichia coli) [Search protein sequence]
GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILG
3D structure
PDB7nww A switch from alpha-helical to beta-strand conformation during co-translational protein folding.
Chaing
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna g G2 Q3 K4 V5 R127 S154 R156 E161 A163 W167 R169 R172 V173 P174 L175 H176 T177 L178 R179 E188 T192 V195 G197 K199 G1 Q2 K3 V4 R126 S153 R155 E160 A162 W166 R168 R171 V172 P173 L174 H175 T176 L177 R178 E187 T191 V194 G196 K198
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Dec 2 07:59:27 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nww', asym_id = 'g', title = 'A switch from alpha-helical to beta-strand conformation during co-translational protein folding.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nww', asym_id='g', title='A switch from alpha-helical to beta-strand conformation during co-translational protein folding.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003676,0003723,0003735,0006412', uniprot = '', pdbid = '7nww', asym_id = 'g'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003723,0003735,0006412', uniprot='', pdbid='7nww', asym_id='g')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>