Structure of PDB 7msc Chain g

Receptor sequence
>7mscg (length=155) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
PRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYGALEQAR
DKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLAL
RWLVGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAF
AHYRW
3D structure
PDB7msc Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chaing
Resolution2.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g P2 R3 K4 P6 A7 R10 N28 K29 V30 G34 K35 K36 S37 L38 I42 R76 G82 R92 R95 T98 R102 R109 K114 M116 W156 P1 R2 K3 P5 A6 R9 N27 K28 V29 G33 K34 K35 S36 L37 I41 R75 G81 R91 R94 T97 R101 R108 K113 M115 W155
BS02 rna g R79 G82 R78 G81
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7msc, PDBe:7msc, PDBj:7msc
PDBsum7msc
PubMed35064151
UniProtP9WH29|RS7_MYCTU Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]