Structure of PDB 7ase Chain g

Receptor sequence
>7aseg (length=83) Species: 5693 (Trypanosoma cruzi) [Search protein sequence]
IGTYNEEGVNVDLYIPRKCHATNNLITSYDHSAVQIAIANVDANGVLNGT
TTTFCIAGYLRRQAESDHAINHLAISKGIIRIK
3D structure
PDB7ase Structural Differences in Translation Initiation between Pathogenic Trypanosomatids and Their Mammalian Hosts.
Chaing
Resolution3.33 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g R65 H75 I78 S79 R84 I85 K86 R62 H72 I75 S76 R81 I82 K83
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000461 endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ase, PDBe:7ase, PDBj:7ase
PDBsum7ase
PubMed33357443
UniProtA0A2V2UKQ3

[Back to BioLiP]