Structure of PDB 6wnt Chain g

Receptor sequence
>6wntg (length=53) Species: 562 (Escherichia coli) [Search protein sequence]
MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEAR
RAE
3D structure
PDB6wnt Ribosome engineering reveals the importance of 5S rRNA autonomy for ribosome assembly.
Chaing
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g N11 K22 G24 Y25 R27 F29 N11 K22 G24 Y25 R27 F29
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wnt, PDBe:6wnt, PDBj:6wnt
PDBsum6wnt
PubMed32518240
UniProtP0A7R1|RL9_ECOLI Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]