Structure of PDB 6n8n Chain g

Receptor sequence

>6n8ng (length=159) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKG
MPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC
RQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTL
APVPYETFI

3D structure

PDB

6n8n Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	G2 K3 S4 H5 G6 Y7 R8 S9 R10 R12 Y13 M14 Q16 R17 H22 K43 Q49 K50 G51 H54 K55 Y57 Q58 K60 T61 T68 K69 S70 S71 K78 V80 R83 L85 K87 R88 E104 F105 V109 N112 R116 K120 Q127 L128 K129 R130	G1 K2 S3 H4 G5 Y6 R7 S8 R9 R11 Y12 M13 Q15 R16 H21 K42 Q48 K49 G50 H53 K54 Y56 Q57 K59 T60 T67 K68 S69 S70 K77 V79 R82 L84 K86 R87 E103 F104 V108 N111 R115 K119 Q126 L127 K128 R129
BS02	rna	g	H26 S28	H25 S27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6n8n, PDBe:6n8n, PDBj:6n8n
PDBsum	6n8n
PubMed	30814529
UniProt	Q02753\|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)

[Back to BioLiP]