Structure of PDB 5xy3 Chain g

Receptor sequence

>5xy3g (length=115) Species: 5722 (Trichomonas vaginalis) [Search protein sequence]

VDNRYTLRRSLGFHTIRNRVAPVRTPGNKLVAHYIAKRQNGPHCAETGKR
INGIKCVKTCELRRMKKNQRTVSRPYGGVYCGSVVKDRIINAFMEEEARA
AQERKMANEQKKKGK

3D structure

PDB

5xy3 Cryo-EM structures of the 80S ribosomes from human parasites Trichomonas vaginalis and Toxoplasma gondii

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	V2 D3 N4 R5 Y6 T7 L8 R9 R10 S11 L12 F14 H15 T16 R18 R20 R25 T26 P27 G28 N29 L31 H34 K38 R39 Q40 N41 G42 H44 K50 R51 N53 G54 I55 K59 T60 R64 R65 K67 K68 N69 R71 T72 S74 R75 Y77	V1 D2 N3 R4 Y5 T6 L7 R8 R9 S10 L11 F13 H14 T15 R17 R19 R24 T25 P26 G27 N28 L30 H33 K37 R38 Q39 N40 G41 H43 K49 R50 N52 G53 I54 K58 T59 R63 R64 K66 K67 N68 R70 T71 S73 R74 Y76

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links