Structure of PDB 5xxb Chain g

Receptor sequence

>5xxbg (length=121) Species: 5811 (Toxoplasma gondii)

KIRAYELRGKSQKELVKQLEDLKKELAQLRVAKVTGSAASKLSKVTEVRK
GIARVLTVYTQKQREEARAAFKGKKFIPNDLRAKKTRAIRRRLTASQTRK
MTVRKMKRTQNVPKRKFALIA

3D structure

• PDB: 5xxb Cryo-EM structures of the 80S ribosomes from human parasites Trichomonas vaginalis and Toxoplasma gondii
• Chain: g
• Resolution: 3.17 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	g	K77 F78 R84 R89 R93 R106 R110 Q112 N113 K116 K118	K75 F76 R82 R87 R91 R104 R108 Q110 N111 K114 K116
BS02	rna	g	R5 Y7 R10 K35 S45 T48 R51 A55 R56 L58 T59 T62 R66 K86 T88 R89 R92	R3 Y5 R8 K33 S43 T46 R49 A53 R54 L56 T57 T60 R64 K84 T86 R87 R90

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Apr 30 00:38:34 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5xxb', asym_id = 'g', title = 'Cryo-EM structures of the 80S ribosomes from hum...sites Trichomonas vaginalis and Toxoplasma gondii'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5xxb', asym_id='g', title='Cryo-EM structures of the 80S ribosomes from hum...sites Trichomonas vaginalis and Toxoplasma gondii')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000463,0003735,0005840,0006412,0022625', uniprot = '', pdbid = '5xxb', asym_id = 'g'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000463,0003735,0005840,0006412,0022625', uniprot='', pdbid='5xxb', asym_id='g')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>