Structure of PDB 5xtc Chain g

Receptor sequence
>5xtcg (length=119) Species: 9606 (Homo sapiens) [Search protein sequence]
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRR
PIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDF
PEEDKKTYGEIFEKFHPIR
3D structure
PDB5xtc Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
Chaing
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PLX g P9 L10 F12 P9 L10 F12
BS02 PLX g L25 F35 F68 L25 F35 F68
BS03 PLX g R48 R59 L62 Y63 F67 R48 R59 L62 Y63 F67
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008137 NADH dehydrogenase (ubiquinone) activity
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0009060 aerobic respiration
GO:0032981 mitochondrial respiratory chain complex I assembly
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005886 plasma membrane
GO:0035577 azurophil granule membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xtc, PDBe:5xtc, PDBj:5xtc
PDBsum5xtc
PubMed28844695
UniProtO95298|NDUC2_HUMAN NADH dehydrogenase [ubiquinone] 1 subunit C2 (Gene Name=NDUFC2)

[Back to BioLiP]