Structure of PDB 5tbw Chain g

Receptor sequence
>5tbwg (length=71) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
KKVYTTPKKIKHKHKKVKLAVLSYYKVDAEGKVTKLRRECSNPTCGAGVF
LANHKDRLYCGKCHSVYKVNA
3D structure
PDB5tbw Synthesis facilitates an understanding of the structural basis for translation inhibition by the lissoclimides.
Chaing
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g K82 K89 K90 I91 K92 K94 H95 K97 A101 V130 F131 A133 N134 H135 R138 Y140 G142 K143 H145 S146 K149 K1 K8 K9 I10 K11 K13 H14 K16 A20 V49 F50 A52 N53 H54 R57 Y59 G61 K62 H64 S65 K68
BS02 ZN g C121 C126 C141 C40 C45 C60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5tbw, PDBe:5tbw, PDBj:5tbw
PDBsum5tbw
PubMed29064494
UniProtP05759|RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS31)

[Back to BioLiP]