Structure of PDB 5nd8 Chain g

Receptor sequence
>5nd8g (length=143) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
VPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVEQRSGR
DALEVFEEAINNIMPVLEVKARSNYQVPVEVRPERRTTLGLRWLVNYARL
RGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFAH
3D structure
PDB5nd8 Structures and dynamics of hibernating ribosomes from Staphylococcus aureus mediated by intermolecular interactions of HPF.
Chaing
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g V7 K9 R10 N28 M31 D33 G34 K35 G37 R41 K76 R92 R95 T98 R102 K114 T115 M116 R119 V1 K3 R4 N22 M25 D27 G28 K29 G31 R35 K70 R82 R85 T88 R92 K104 T105 M106 R109
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nd8, PDBe:5nd8, PDBj:5nd8
PDBsum5nd8
PubMed28645916
UniProtP48940|RS7_STAA8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]