Structure of PDB 5jcs Chain g

Receptor sequence
>5jcsg (length=112) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK
3D structure
PDB5jcs Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
Chaing
Resolution9.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna g A2 V5 R8 R9 Y13 V22 T25 P26 G27 G45 A63 T64 A75 G77 G78 E87 R88 A1 V4 R7 R8 Y12 V21 T24 P25 G26 G44 A62 T63 A74 G76 G77 E86 R87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jcs, PDBe:5jcs, PDBj:5jcs
PDBsum5jcs
PubMed26619264
UniProtP87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)

[Back to BioLiP]