Structure of PDB 4xk8 Chain g

Receptor sequence
>4xk8g (length=95) Species: 3888 (Pisum sativum) [Search protein sequence]
ELSPSLVISLSTGLSLFLGRFVFFNFQRENVAKQVPEQNGLTHFEAGDTR
AKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATTSNGYDP
3D structure
PDB4xk8 Structural basis for energy transfer pathways in the plant PSI-LHCI supercomplex
Chaing
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA g A87 N91 A87 N91
BS02 CLA g F26 Q27 N30 V31 Q34 F26 Q27 N30 V31 Q34
BS03 CLA g T88 N91 Y93 T88 N91 Y93
BS04 CLA g S5 I8 S9 H79 Y83 S5 I8 S9 H79 Y83
BS05 CLA g L16 R20 F21 N61 D62 P63 F66 I68 V71 L16 R20 F21 N61 D62 P63 F66 I68 V71
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xk8, PDBe:4xk8, PDBj:4xk8
PDBsum4xk8
PubMed26023133
UniProtP12357|PSAG_SPIOL Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]