Structure of PDB 4v7f Chain g |
>4v7fg (length=99) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
TVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLS PYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH |
|
PDB | 4v7f 60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle. |
Chain | g |
Resolution | 8.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
g |
R98 R99 |
R97 R98 |
|
|
|
|