Structure of PDB 4v4j Chain g |
>4v4jg (length=101) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] |
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAY PIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLAN A |
|
PDB | 4v4j Interactions and dynamics of the Shine Dalgarno helix in the 70S ribosome. |
Chain | g |
Resolution | 3.83 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
g |
Y50 N73 R80 R87 |
Y50 N73 R80 R87 |
|
|
|
|