Structure of PDB 3ld0 Chain g |
>3ld0g (length=53) Species: 279010 (Bacillus licheniformis DSM 13 = ATCC 14580) [Search protein sequence] |
MVIATDDLETTCPNCNGSGREEPEPCPKCLGKGVILTAQGSTLLHFIKKH IHE |
|
PDB | 3ld0 Bacillus licheniformis Anti-TRAP can assemble into two types of dodecameric particles with the same symmetry but inverted orientation of trimers. |
Chain | g |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
g |
C212 C215 C226 C229 |
C12 C15 C26 C29 |
|
|
|
|