Structure of PDB 8scb Chain ff

Receptor sequence
>8scbff (length=63) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
KSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSVFMASHFDR
HYCGKCCLTYCFN
3D structure
PDB8scb Structure and consequences of eRF1 glued to the ribosomal decoding center
Chainff
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna ff Y80 K85 N86 K87 H88 K89 R90 K92 K94 A96 V97 Y100 V125 F126 A128 H130 R133 Y135 G137 K138 T142 Y3 K8 N9 K10 H11 K12 R13 K15 K17 A19 V20 Y23 V42 F43 A45 H47 R50 Y52 G54 K55 T59
BS02 ZN ff C116 S118 C139 C39 S41 C56
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8scb, PDBe:8scb, PDBj:8scb
PDBsum8scb
PubMed38172604
UniProtG1SK22|RS27A_RABIT Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS27A)

[Back to BioLiP]