Structure of PDB 3jah Chain ff

Receptor sequence
>3jahff (length=62) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
KSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSFMASHFDRH
YCGKCCLTYCFN
3D structure
PDB3jah Structural basis for stop codon recognition in eukaryotes.
Chainff
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna ff Y80 K85 N86 K87 H88 R90 K92 A96 V97 A128 H130 Y135 G137 K138 Y3 K8 N9 K10 H11 R13 K15 A19 V20 A44 H46 Y51 G53 K54
BS02 ZN ff C116 C139 C39 C55
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jah, PDBe:3jah, PDBj:3jah
PDBsum3jah
PubMed26245381
UniProtG1SK22|RS27A_RABIT Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS27A)

[Back to BioLiP]