Structure of PDB 5y6p Chain fd

Receptor sequence
>5y6pfd (length=196) Species: 35689 (Griffithsia pacifica) [Search protein sequence]
AFSSIDRILTADPVAFPNGTESVIRATYIQVFGNAHVMDSEREELATAES
NVCRTGNVREFVRAIVLSENYKSRFFYSVSQYRFIELMFKHILGRAPESR
AEYAEAMAVYNTKGYEPLVSWFVDSLEYNENFGSWIVPYGIYQGCYSSNE
LFNRSVAMRLAPGCSDKGRSAMLQYCVLSGDSPNWLSISKALPAGT
3D structure
PDB5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
Chainfd
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 PEB fd M214 Y217 C218 D223 P225 M172 Y175 C176 D181 P183
BS02 PEB fd I47 C187 Y188 F194 I5 C145 Y146 F152
BS03 PEB fd Q123 Y124 Y145 A146 M149 Q81 Y82 Y103 A104 M107
BS04 PEB fd H78 S207 K209 H36 S165 K167
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Dec 1 08:23:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'fd', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='fd', title='Structure of phycobilisome from the red alga Griffithsia pacifica')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'fd'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='fd')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>