Structure of PDB 6q9e Chain f2

Receptor sequence
>6q9ef2 (length=195) Species: 9940 (Ovis aries) [Search protein sequence]
HTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLITATTTVGVAYAA
KNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHR
TKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAG
DFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
3D structure
PDB6q9e Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.
Chainf2
Resolution3.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES f2 C139 H141 L142 C158 H161 S163 C138 H140 L141 C157 H160 S162
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 08:56:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6q9e', asym_id = 'f2', title = 'Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6q9e', asym_id='f2', title='Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0008121,0016020,0051537', uniprot = '', pdbid = '6q9e', asym_id = 'f2'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008121,0016020,0051537', uniprot='', pdbid='6q9e', asym_id='f2')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>