Structure of PDB 5m1j Chain f2

Receptor sequence
>5m1jf2 (length=71) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KKVYTTPKKIKHKHKKVKLAVLSYYKVDAEGKVTKLRRECSNPTCGAGVF
LANHKDRLYCGKCHSVYKVNA
3D structure
PDB5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
Chainf2
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f2 K89 K94 H95 K99 F131 A133 H135 Y140 G142 K143 H145 S146 K8 K13 H14 K18 F50 A52 H54 Y59 G61 K62 H64 S65
BS02 ZN f2 N123 C141 C144 N42 C60 C63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
PDBsum5m1j
PubMed27995908
UniProtP05759|RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS31)

[Back to BioLiP]