Structure of PDB 6q9e Chain f1

Receptor sequence
>6q9ef1 (length=196) Species: 9940 (Ovis aries) [Search protein sequence]
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLITATTTVGVAYA
AKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRH
RTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANA
GDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
3D structure
PDB6q9e Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.
Chainf1
Resolution3.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES f1 C139 H141 L142 C158 H161 S163 C139 H141 L142 C158 H161 S163
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun May 11 21:24:11 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1472         else:
=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1474     
   1475     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6q9e', asym_id = 'f1', title = 'Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6q9e', asym_id='f1', title='Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.')
    840 
    841     if go:
=>  842         display_go(go,uniprot,pdbid,asym_id)
    843     return pubmed,uniprot
    844 
global display_go = <function display_go>, go = '0008121,0016020,0051537', uniprot = '', pdbid = '6q9e', asym_id = 'f1'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008121,0016020,0051537', uniprot='', pdbid='6q9e', asym_id='f1')
    481         '''.replace("$namespace_link",namespace_link
    482           ).replace("$namespace",namespace
=>  483           ).replace("$uniprot",u
    484         ))
    485         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>