Structure of PDB 8wmw Chain f

Receptor sequence

>8wmwf (length=174) Species: 52970 (Rhodomonas salina) [Search protein sequence]

AMSESVPFLKKPEALDSSMAGYAGFDPLGLSSIADIKFLQESEIKHCRIA
MLAAAGSIAQDIFTFPGVSKVVGTAKMTGVHDVLVKQGAMGQILLWTSFL
EVFGTIALLETLDGKRAPGDFKFDPLGFSKNAETAKRYQLSEIKNGRLAM
LATGGMVHGYFITGKGPLELLTNF

3D structure

PDB

8wmw Growth phase-dependent reorganization of cryptophyte photosystem I antennae.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	f	E40 S41 V42 P43 F61	E4 S5 V6 P7 F25
BS02	CLA	f	L51 Y58 A59 F61 D62 L75 E79 R183 M186	L15 Y22 A23 F25 D26 L39 E43 R147 M150
BS03	CLA	f	L88 A89 G92 Q96 F99 T100 F101 V104 L120 M126	L52 A53 G56 Q60 F63 T64 F65 V68 L84 M90
BS04	CLA	f	F101 P102 G103 V104	F65 P66 G67 V68
BS05	CLA	f	A125 Q128 W132	A89 Q92 W96
BS06	CLA	f	H117 V121 M126 G127 I129	H81 V85 M90 G91 I93
BS07	CLA	f	F74 K81 H82 I85 S134 E137	F38 K45 H46 I49 S98 E101
BS08	CLA	f	R84 M87 D156 F157 K158 F159 D160 F164 S165 Y174 Q175 E178 N181	R48 M51 D120 F121 K122 F123 D124 F128 S129 Y138 Q139 E142 N145
BS09	CLA	f	S177 K180 L184	S141 K144 L148
BS10	KC2	f	Y174 N181	Y138 N145
BS11	CLA	f	L187 G191 H194	L151 G155 H158
BS12	CLA	f	H194 F197	H158 F161
BS13	II0	f	M87 A90 F159 D160 P161 A185 A188 G191 M192	M51 A54 F123 D124 P125 A149 A152 G155 M156
BS14	II0	f	F61 D62 P63 L64 A89 Q96 M113 M186	F25 D26 P27 L28 A53 Q60 M77 M150
BS15	II0	f	K180 R183 L184 L187	K144 R147 L148 L151
BS16	IHT	f	T114 H117 G190 V193 H194 F197	T78 H81 G154 V157 H158 F161
BS17	II0	f	K81 R84 I85 I129 T133 E137	K45 R48 I49 I93 T97 E101

External links

PDB	RCSB:8wmw, PDBe:8wmw, PDBj:8wmw
PDBsum	8wmw
PubMed	38734819

[Back to BioLiP]