Structure of PDB 8wid Chain f

Receptor sequence

>8widf (length=166) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

NYIERVVSINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAA
IAKGVEEARKNFFRVPLIGSTITHPVQGEAAAGVVMLRPASPGTGVIAGG
AARAVLECAGVHDILAKSLGSDNAINVVHATVAALKLLQRPEEVAARRGL
PIEDVAPAGMLKARRE

3D structure

• PDB: 8wid Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: f
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	N44 V46 S47 V49 V50 K51 G52 R54 R55 Y75 K77 K87 A116 M120 R122 P123 A124 S125 T128 I131 A132 G133 R137 L149 K151 S155 D156 N157 N160	N10 V12 S13 V15 V16 K17 G18 R20 R21 Y41 K43 K53 A82 M86 R88 P89 A90 S91 T94 I97 A98 G99 R103 L115 K117 S121 D122 N123 N126

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wid, PDBe:8wid, PDBj:8wid
• PDBsum: 8wid
• PubMed: 38245551
• UniProt: A0QSG6|RS5_MYCS2 Small ribosomal subunit protein uS5 (Gene Name=rpsE)