Structure of PDB 8wib Chain f

Receptor sequence
>8wibf (length=166) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
NYIERVVSINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAA
IAKGVEEARKNFFRVPLIGSTITHPVQGEAAAGVVMLRPASPGTGVIAGG
AARAVLECAGVHDILAKSLGSDNAINVVHATVAALKLLQRPEEVAARRGL
PIEDVAPAGMLKARRE
3D structure
PDB8wib Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chainf
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f N44 S47 V49 K51 G52 R54 R55 Y75 K77 K87 M120 R122 A124 S125 T128 I131 A132 G133 R137 L149 K151 S155 D156 N157 N160 N10 S13 V15 K17 G18 R20 R21 Y41 K43 K53 M86 R88 A90 S91 T94 I97 A98 G99 R103 L115 K117 S121 D122 N123 N126
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wib, PDBe:8wib, PDBj:8wib
PDBsum8wib
PubMed38245551
UniProtA0QSG6|RS5_MYCS2 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]