Structure of PDB 8q5i Chain f

Receptor sequence
>8q5if (length=56) Species: 5476 (Candida albicans) [Search protein sequence]
GSLARAGKVKSQTPKVEKQEKPKKPQGRAYMRLLYTRRFVNVTLTNGKRK
MNPSPA
3D structure
PDB8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
Chainf
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f R10 K13 V14 K15 Q17 T18 V21 K23 Q24 E25 K26 K28 Q31 R33 A34 R37 R42 R43 V45 K55 M56 N57 S59 R5 K8 V9 K10 Q12 T13 V16 K18 Q19 E20 K21 K23 Q26 R28 A29 R32 R37 R38 V40 K50 M51 N52 S54
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum8q5i
PubMed
UniProtA0A1D8PSK2|RS30_CANAL Small ribosomal subunit protein eS30 (Gene Name=RPS30)

[Back to BioLiP]