Structure of PDB 8p2g Chain f

Receptor sequence

>8p2gf (length=156) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

FEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAI
KKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGP
VRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKT
VEELYN

3D structure

PDB

8p2g Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid

Chain

Resolution

2.02 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	N19 V21 A22 K23 V24 V25 K26 R29 R30 K52 Y89 S91 F95 A99 A100 T103 I106 A107 G108 R112 L124 S125 K126 S127 L128 S130 N131 T132 I134 N135 R138	N9 V11 A12 K13 V14 V15 K16 R19 R20 K42 Y79 S81 F85 A89 A90 T93 I96 A97 G98 R102 L114 S115 K116 S117 L118 S120 N121 T122 I124 N125 R128

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8p2g, PDBe:8p2g, PDBj:8p2g
PDBsum	8p2g
PubMed	38902339
UniProt	Q2FW23\|RS5_STAA8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]