Structure of PDB 8oz0 Chain f

Receptor sequence
>8oz0f (length=184) Species: 9606 (Homo sapiens) [Search protein sequence]
DIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQ
CPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNA
IINSGPREDSTRIGRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIA
ECLADELINAAKGSSNSYAIKKKDELERVAKSNR
3D structure
PDB8oz0 The structure of a human translation initiation complex reveals two independent roles for the helicase eIF4A.
Chainf
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f H51 A57 R60 M78 N82 N83 G84 K85 K86 L87 M88 R159 R164 N165 I166 T168 I169 H36 A42 R45 M63 N67 N68 G69 K70 K71 L72 M73 R139 R144 N145 I146 T148 I149
BS02 MG f A96 L173 A81 L153
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006413 translational initiation
GO:0006450 regulation of translational fidelity
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oz0, PDBe:8oz0, PDBj:8oz0
PDBsum8oz0
PubMed38287194
UniProtP46782|RS5_HUMAN Small ribosomal subunit protein uS7 (Gene Name=RPS5)

[Back to BioLiP]